PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15164A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 247aa    MW: 27671.2 Da    PI: 8.7357
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15164AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.3e-152166148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg++ + E+ ++v++ ++lG++ W+tIa++++  Rt++q+k++w+++l
  Oropetium_20150105_15164A 21 RGNFMPHEESIIVNLQALLGNR-WATIASYLP-QRTDNQIKNYWNSHL 66
                               79999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.217115IPR017877Myb-like domain
SuperFamilySSF466893.84E-19272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-8226IPR009057Homeodomain-like
PROSITE profilePS5129422.5261670IPR017930Myb domain
SMARTSM007174.0E-122068IPR001005SANT/Myb domain
PfamPF002492.0E-122166IPR001005SANT/Myb domain
CDDcd001671.45E-92666No hitNo description
Gene3DG3DSA:1.10.10.603.7E-192771IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MRCRKSCRLR WTNHLRPGIR RGNFMPHEES IIVNLQALLG NRWATIASYL PQRTDNQIKN  60
YWNSHLKKKL NKHQAIGEIF APPPYDLSTT FPAVTSTTVT NPLSKGGNYP RATCINPADV  120
TQLITRRTPF AAVPGSPDAN RGFSYSASSD ALSMDDISKM IHGFMKKSTM PQNDAADLRP  180
SATEDNHLLS XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXENWLLDE AADQVVDLMG  240
LSDSCC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1827140109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978476.15e-64PREDICTED: transcription factor MYB30-like
TrEMBLL0P1U97e-65L0P1U9_9POAL; PH01B001E05.10 protein
STRINGSi026651m2e-63(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-40myb domain protein 60